PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv_009450_upnr.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 355aa    MW: 39680.6 Da    PI: 6.4305
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv_009450_upnr.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.41.2e-18128180456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        + +++ eq+++Le+ Fe+ +++  +++ +LAk lgL+ rqV +WFqNrRa++k
  Bv_009450_upnr.t1 128 KKRLNMEQVKTLEKNFEQGNKLEPDRKIQLAKALGLQPRQVAIWFQNRRARWK 180
                        556899**********************************************9 PP

2HD-ZIP_I/II129.91e-41126217192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekk+rl+ eqvk+LE++Fe+ +kLep+rK +la++Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr++d+lk++n++L +++++L++el 
  Bv_009450_upnr.t1 126 EKKKRLNMEQVKTLEKNFEQGNKLEPDRKIQLAKALGLQPRQVAIWFQNRRARWKTKQLEKDYSVLKRQFDSLKADNDSLLSHNKKLHAELI 217
                        69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.07E-19113184IPR009057Homeodomain-like
PROSITE profilePS5007116.811122182IPR001356Homeobox domain
SMARTSM003895.3E-18125186IPR001356Homeobox domain
CDDcd000869.74E-17127183No hitNo description
PfamPF000466.8E-16127180IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-19129189IPR009057Homeodomain-like
PRINTSPR000311.7E-5153162IPR000047Helix-turn-helix motif
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
PRINTSPR000311.7E-5162178IPR000047Helix-turn-helix motif
PfamPF021831.1E-16182222IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAFLSQDYMM YQPHHHNNNH NHHDFNDHDD HHQDPSISLN ILSSCPPQEF QGAPAVASLA  60
MMNRSMSFSG YHLHQIDPNH QQDDVVGGHE EHENHNHHHD HGGGGDQDEL SDDGSQVVLV  120
GPGGGEKKKR LNMEQVKTLE KNFEQGNKLE PDRKIQLAKA LGLQPRQVAI WFQNRRARWK  180
TKQLEKDYSV LKRQFDSLKA DNDSLLSHNK KLHAELIALR NREPAEYGVI NLNNADTKSY  240
WSNNGSEISS DMNLNTSRTV TPRTGSPLSS NPSTKLQFPP NSFIPTSITQ FLQASSPKPE  300
LDLQCPKIDP QHLPDDTFCT MYGAASGGGG GGGSGGIENQ PPSFWAWPDQ QQNLN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667539.10.0PREDICTED: homeobox-leucine zipper protein HAT7-like
TrEMBLA0A0J8B6050.0A0A0J8B605_BETVU; Uncharacterized protein
STRINGPOPTR_0017s11800.11e-84(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.13e-67homeobox 3